VIMSS7515 has 114 amino acids
Query: DUF496 [M=93]
Accession: PF04363.16
Description: Protein of unknown function (DUF496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-42 130.3 14.1 1.5e-42 129.9 14.1 1.1 1 VIMSS7515
Domain annotation for each sequence (and alignments):
>> VIMSS7515
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 129.9 14.1 1.5e-42 1.5e-42 1 92 [. 9 100 .. 9 101 .. 0.98
Alignments for each domain:
== domain 1 score: 129.9 bits; conditional E-value: 1.5e-42
DUF496 1 lenvlelvrkarrknklkreiednekkirdnqkrvellenlleyikpdmsieeikaiienmksdyedrvddyiiknaelskerrelskklke 92
+++vle+vr++r kn++kr++edn++kirdnqkr++ll+nl++yi++dm+i+e++ iie+m++dye rvddy+i+naelsk+rre s+k+ke
VIMSS7515 9 FQDVLEYVRMYRLKNRIKRDMEDNNRKIRDNQKRILLLDNLNQYIRDDMTIAEVRGIIESMRDDYESRVDDYTIRNAELSKQRREASTKMKE 100
689***************************************************************************************96 PP
Or compare VIMSS7515 to CDD or PaperBLAST