PaperBLAST – Find papers about a protein or its homologs

 

Align F6SQH7 to PF04379 (DUF525)

F6SQH7 has 284 amino acids

Query:       DUF525  [M=87]
Accession:   PF04379.14
Description: ApaG domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.9e-18   52.2   0.0    5.9e-18   51.3   0.0    1.4  1  F6SQH7    


Domain annotation for each sequence (and alignments):
>> F6SQH7  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   51.3   0.0   5.9e-18   5.9e-18       4      60 ..     220     276 ..     218     278 .. 0.94

  Alignments for each domain:
  == domain 1  score: 51.3 bits;  conditional E-value: 5.9e-18
             -BTTB--EEEEEEEEEEE-SSS-EEEEEEEEEEEETTS-EEEEEEESBTTB--EE-T CS
  DUF525   4 sspeeekyvfaYsirieneseesvqLlsRhweitdadgkveevegeGvvGeqPlLep 60 
             ++++++ y+++Y ir+en  ++ vqL++Rhw+i + +g+ e+v+g+GvvG+  +L p
  F6SQH7 220 EAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRGVVGRVSILGP 276
             5678999*******************************************9988866 PP



Or compare F6SQH7 to CDD or PaperBLAST