PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS57042 to PF04379 (DUF525)

VIMSS57042 has 126 amino acids

Query:       DUF525  [M=87]
Accession:   PF04379.17
Description: ApaG domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.2e-40  123.9   0.0    1.5e-40  123.7   0.0    1.1  1  VIMSS57042  


Domain annotation for each sequence (and alignments):
>> VIMSS57042  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  123.7   0.0   1.5e-40   1.5e-40       1      85 [.      18     102 ..      18     104 .. 0.98

  Alignments for each domain:
  == domain 1  score: 123.7 bits;  conditional E-value: 1.5e-40
                 EE--BTTB--EEEEEEEEEEE-SSS-EEEEEEEEEEEETTS-EEEEEEESBTTB--EE-TTEEEEEEEEEEESSSEEEEEEEEEE CS
      DUF525   1 eeqsspeeekyvFaYsirieneseesvqLlsrhweitdangkveevegegVvgeqPlLkpgesFeYtsgvsletpsGsmeGsytm 85 
                 +eqs+pe+++++FaY+++ien++e ++qLlsrhw+itd++g+++ev+g gVvgeqPl++pg++++Ytsg+ l+t++Gsm+Gsy+m
  VIMSS57042  18 PEQSAPEQNRFAFAYTVTIENQGEVPAQLLSRHWIITDGDGRTQEVRGAGVVGEQPLIAPGAQHTYTSGTVLATRVGSMRGSYQM 102
                 689*********************************************************************************9 PP



Or compare VIMSS57042 to CDD or PaperBLAST