VIMSS57042 has 126 amino acids
Query: DUF525 [M=87] Accession: PF04379.17 Description: ApaG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-40 123.9 0.0 1.5e-40 123.7 0.0 1.1 1 VIMSS57042 Domain annotation for each sequence (and alignments): >> VIMSS57042 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 123.7 0.0 1.5e-40 1.5e-40 1 85 [. 18 102 .. 18 104 .. 0.98 Alignments for each domain: == domain 1 score: 123.7 bits; conditional E-value: 1.5e-40 EE--BTTB--EEEEEEEEEEE-SSS-EEEEEEEEEEEETTS-EEEEEEESBTTB--EE-TTEEEEEEEEEEESSSEEEEEEEEEE CS DUF525 1 eeqsspeeekyvFaYsirieneseesvqLlsrhweitdangkveevegegVvgeqPlLkpgesFeYtsgvsletpsGsmeGsytm 85 +eqs+pe+++++FaY+++ien++e ++qLlsrhw+itd++g+++ev+g gVvgeqPl++pg++++Ytsg+ l+t++Gsm+Gsy+m VIMSS57042 18 PEQSAPEQNRFAFAYTVTIENQGEVPAQLLSRHWIITDGDGRTQEVRGAGVVGEQPLIAPGAQHTYTSGTVLATRVGSMRGSYQM 102 689*********************************************************************************9 PP
Or compare VIMSS57042 to CDD or PaperBLAST