PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7779318 to PF04379 (DUF525)

VIMSS7779318 has 126 amino acids

Query:       DUF525  [M=87]
Accession:   PF04379.14
Description: ApaG domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.6e-37  112.8   0.1    4.4e-37  112.6   0.1    1.1  1  VIMSS7779318  


Domain annotation for each sequence (and alignments):
>> VIMSS7779318  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  112.6   0.1   4.4e-37   4.4e-37       2      86 ..      19     103 ..      18     104 .. 0.98

  Alignments for each domain:
  == domain 1  score: 112.6 bits;  conditional E-value: 4.4e-37
                   E--BTTB--EEEEEEEEEEE-SSS-EEEEEEEEEEEETTS-EEEEEEESBTTB--EE-TTEEEEEEEEEEESSSEEEEEEEEEEE CS
        DUF525   2 eqsspeeekyvfaYsirieneseesvqLlsRhweitdadgkveevegeGvvGeqPlLepgesFeYtSgvsletpsGsmeGsytmv 86 
                   +qs+pe+++++faY+i+++n++  +++LlsRhw+itd+dg+veev+g GvvG+qPl+  g s++Y+Sg+ +++++G+m+Gsy+m+
  VIMSS7779318  19 DQSQPEQNRFAFAYTITVKNNGLVPAKLLSRHWVITDGDGQVEEVRGAGVVGQQPLIDIGASHTYSSGTVMTSKVGTMQGSYQMK 103
                   79**********************************************************************************7 PP



Or compare VIMSS7779318 to CDD or PaperBLAST