VIMSS7779318 has 126 amino acids
Query: DUF525 [M=87]
Accession: PF04379.18
Description: ApaG domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.3e-39 118.7 0.1 6.4e-39 118.4 0.1 1.1 1 VIMSS7779318
Domain annotation for each sequence (and alignments):
>> VIMSS7779318
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 118.4 0.1 6.4e-39 6.4e-39 2 86 .. 19 103 .. 18 104 .. 0.98
Alignments for each domain:
== domain 1 score: 118.4 bits; conditional E-value: 6.4e-39
DUF525 2 eqsspeeeryvFaYtirienegeesvqLlsrhwiitdangkveevegegVvgeqPvLkpgesfeYtsgvsletpsGsmeGsytmv 86
+qs+pe++r++FaYti+++n+g +++Llsrhw+itd++g+veev+g gVvg+qP++ g+s++Y+sg+++++++G+m+Gsy+m+
VIMSS7779318 19 DQSQPEQNRFAFAYTITVKNNGLVPAKLLSRHWVITDGDGQVEEVRGAGVVGQQPLIDIGASHTYSSGTVMTSKVGTMQGSYQMK 103
79**********************************************************************************7 PP
Or compare VIMSS7779318 to CDD or PaperBLAST