PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS91524 to PF04379 (DUF525)

VIMSS91524 has 125 amino acids

Query:       DUF525  [M=87]
Accession:   PF04379.14
Description: ApaG domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    8.5e-38  114.9   0.0      1e-37  114.6   0.0    1.1  1  VIMSS91524  


Domain annotation for each sequence (and alignments):
>> VIMSS91524  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  114.6   0.0     1e-37     1e-37       2      86 ..      18     102 ..      17     103 .. 0.98

  Alignments for each domain:
  == domain 1  score: 114.6 bits;  conditional E-value: 1e-37
                 E--BTTB--EEEEEEEEEEE-SSS-EEEEEEEEEEEETTS-EEEEEEESBTTB--EE-TTEEEEEEEEEEESSSEEEEEEEEEEE CS
      DUF525   2 eqsspeeekyvfaYsirieneseesvqLlsRhweitdadgkveevegeGvvGeqPlLepgesFeYtSgvsletpsGsmeGsytmv 86 
                  qssp++e+yvfaY+++i+n ++ +vqLl R+w it+++g+++ev+geGvvG qPl++pge+++YtSg+ +etp G+m+G+y+m 
  VIMSS91524  18 AQSSPDNERYVFAYTVTIRNLGRAPVQLLGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMI 102
                 699********************************************************************************96 PP



Or compare VIMSS91524 to CDD or PaperBLAST