PaperBLAST – Find papers about a protein or its homologs

 

Align WP_004385583.1 to PF04379 (DUF525)

WP_004385583.1 has 125 amino acids

Query:       DUF525  [M=87]
Accession:   PF04379.14
Description: ApaG domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    7.8e-37  111.8   0.1    9.6e-37  111.5   0.1    1.1  1  WP_004385583.1  


Domain annotation for each sequence (and alignments):
>> WP_004385583.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  111.5   0.1   9.6e-37   9.6e-37       2      86 ..      18     102 ..      17     103 .. 0.98

  Alignments for each domain:
  == domain 1  score: 111.5 bits;  conditional E-value: 9.6e-37
                     E--BTTB--EEEEEEEEEEE-SSS-EEEEEEEEEEEETTS-EEEEEEESBTTB--EE-TTEEEEEEEEEEESSSEEEEEEEEEEE CS
          DUF525   2 eqsspeeekyvfaYsirieneseesvqLlsRhweitdadgkveevegeGvvGeqPlLepgesFeYtSgvsletpsGsmeGsytmv 86 
                      qsspe+e++vfaY+++++n ++ +vqLl R+w it+++gk++ev+geGvvG qP+++pg +++YtSg+ +etp G+m+G+y+mv
  WP_004385583.1  18 AQSSPEDERFVFAYTVTVRNLGRTPVQLLGRYWLITNGNGKETEVQGEGVVGVQPHIQPGGEYQYTSGAVIETPFGTMQGHYEMV 102
                     699*********************************************************************************8 PP



Or compare WP_004385583.1 to CDD or PaperBLAST