PaperBLAST – Find papers about a protein or its homologs

 

Align P33218 to PF04391 (DUF533)

P33218 has 219 amino acids

Query:       DUF533  [M=179]
Accession:   PF04391.12
Description: Protein of unknown function (DUF533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.2e-52  164.2   0.4    1.5e-52  163.9   0.4    1.1  1  P33218    


Domain annotation for each sequence (and alignments):
>> P33218  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  163.9   0.4   1.5e-52   1.5e-52       5     178 ..      33     209 ..      29     210 .. 0.89

  Alignments for each domain:
  == domain 1  score: 163.9 bits;  conditional E-value: 1.5e-52
  DUF533   5 gaaaggllglllGskkgr....klgkkalklGglAalGglAykayqnwqanqqeaapqsapkf.q.e.eeeekaelllrAmiaAAkADGhideeErqrIlqel 100
             ++a+ggl+gll+++k++r    k+g++al +Gg A+ G++ +++y++      +aa q +p+f   +   +e+  +l+ A++ AAk+DGhid++Er++I q+l
  P33218  33 PGALGGLAGLLVANKSARklltKYGTNALLVGGGAVAGTVLWNKYKDKI----RAAHQDEPQFgAqStPLDERTARLILALVFAAKSDGHIDAKERAAIDQQL 131
             6789************8888889***********************543....23333334433222356777788888************************ PP

  DUF533 101 eelgldaeekalledeLrkPldlqelaaavknpelaaevYlaSllaidedsaaEraYLdeLaqaLgLdpelvaeleaq 178
             + +g++++ + l+e+++++Pld+q+la  v+n+e+a e+Y++S++aid d+++Er+YL++L +aL++++++++ +e++
  P33218 132 RGAGVEEQGRVLIEQAIEQPLDPQRLATGVRNEEEALEIYFLSCAAIDIDHFMERSYLNALGDALKIPQDVRDGIERD 209
             **************************************************************************9986 PP



Or compare P33218 to CDD or PaperBLAST