PaperBLAST – Find papers about a protein or its homologs

 

Align Q82V70 to PF04391 (DUF533)

Q82V70 has 268 amino acids

Query:       DUF533  [M=179]
Accession:   PF04391.12
Description: Protein of unknown function (DUF533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    5.6e-53  165.3   7.2    9.2e-53  164.6   7.2    1.4  1  Q82V70    


Domain annotation for each sequence (and alignments):
>> Q82V70  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  164.6   7.2   9.2e-53   9.2e-53       8     177 ..      89     260 ..      58     262 .. 0.89

  Alignments for each domain:
  == domain 1  score: 164.6 bits;  conditional E-value: 9.2e-53
  DUF533   8 aggllglllGskkgrklgkkalklGglAalGglAykayqnwqanqq.eaapqsapkfq.e..eeeekaelllrAmiaAAkADGhideeErqrIlqeleelgld 106
              g+l+g+ll+++   k++k+al ++++A+lG+lA++a++ + a  + +a+++  +++  e  ++ ++++l++rAmiaAAkADG ide+E++rIl++++e+g++
  Q82V70  89 IGALAGALLSGGV--KASKGALGGSAMAILGSLALNALKGHLAAGNtSASAADIDRYAmEaiDDPDTQRLIVRAMIAAAKADGIIDEQENARILGKVGEDGVT 189
             4667******999..************************5544433033333322222234799*************************************** PP

  DUF533 107 aeekalledeLrkPldlqelaaavknpelaaevYlaSllaidedsaaEraYLdeLaqaLgLdpelvaelea 177
             + e++l+++eLr+P+d+++l+a+v+n+ +aaevY aSllai++d+++E++YL+eLa+ LgLd++ va+l++
  Q82V70 190 EAERQLVDEELRRPADMAALVAEVPNQVVAAEVYSASLLAINVDTEKEENYLRELAKLLGLDAAAVARLHQ 260
             **********************************************************************8 PP



Or compare Q82V70 to CDD or PaperBLAST