PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1053659 to PF04391 (DUF533)

VIMSS1053659 has 235 amino acids

Query:       DUF533  [M=179]
Accession:   PF04391.12
Description: Protein of unknown function (DUF533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.9e-61  192.9   3.3    2.3e-61  192.6   3.3    1.1  1  VIMSS1053659  


Domain annotation for each sequence (and alignments):
>> VIMSS1053659  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  192.6   3.3   2.3e-61   2.3e-61       4     179 .]      37     230 ..      34     230 .. 0.89

  Alignments for each domain:
  == domain 1  score: 192.6 bits;  conditional E-value: 2.3e-61
        DUF533   4 ggaaaggllglllGskkgrklgkkalklGglAalGglAykayqnwqanqq.eaapqs...apk...........f.q.e..eeeekaelllrAmiaA 81 
                   +++a+g+++++++G+k+grkl+++++++Gg+Aa++gl y ay+n++++q+ ++a+q+   +             f + +   ++++a +l++AmiaA
  VIMSS1053659  37 NPLATGAIAAAIFGTKTGRKLAGNVATVGGIAAIAGLGYLAYKNYKSGQApQEAEQPvakE-PellpappadspFhPhSpaMSNSFALTLVQAMIAA 132
                   67899****************************************9998853333334441.04555556677754442569*************** PP

        DUF533  82 AkADGhideeErqrIlqeleelgldaeekalledeLrkPldlqelaaavknpelaaevYlaSllaidedsaaEraYLdeLaqaLgLdpelvaeleaq 178
                   A+ADG id++Er+rI+++++ +gld+e++a+l++eL++P+dl+ l+aa++++e+++e+Y+aS+laid+d++aEr YLd+La +LgL+++lv+++ea+
  VIMSS1053659 133 ARADGYIDDAERARIMEKVKISGLDDEAEAFLARELAEPVDLDVLVAAAQTEEQKVELYTASRLAIDPDNRAERGYLDMLAGRLGLQDALVDHIEAT 229
                   ***********************************************************************************************98 PP

        DUF533 179 v 179
                   v
  VIMSS1053659 230 V 230
                   6 PP



Or compare VIMSS1053659 to CDD or PaperBLAST