PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1138576 to PF04391 (DUF533)

VIMSS1138576 has 227 amino acids

Query:       DUF533  [M=179]
Accession:   PF04391.12
Description: Protein of unknown function (DUF533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.5e-46  144.4   0.1    1.9e-46  144.0   0.1    1.0  1  VIMSS1138576  


Domain annotation for each sequence (and alignments):
>> VIMSS1138576  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  144.0   0.1   1.9e-46   1.9e-46       5     179 .]      35     217 ..      31     217 .. 0.90

  Alignments for each domain:
  == domain 1  score: 144.0 bits;  conditional E-value: 1.9e-46
        DUF533   5 gaaaggllglllGskkgrklgkkalklGglAalGglAykayqnwqanqqeaapqsapk.....fqe....eeeekaelllrAmiaAAkADGhideeE 92 
                   +++a  ++g llG ++   ++++a++ G +A+ +++A +a+++w+++ +  ++++ ++     + +    ++e   e+ll+Am+aAAk+ G++ +eE
  VIMSS1138576  35 SGLADLIAGFLLGDRSRCCVAGAAARRGIVALSCVVAGRAWADWRDGCDPMTESTVEErvplgL-DddggAAEGLCERLLQAMVAAAKSGGRVCREE 130
                   5678889*********99***************************9998444333222333333.1346799************************* PP

        DUF533  93 rqrIlqeleelgldaeekalledeLrkPldlqelaaavknpelaaevYlaSllaidedsaaEraYLdeLaqaLgLdpelvaeleaqv 179
                   r+ I+++l+el+ld e++al+++eL++P d+ ++a+ +++pe+aa +Y+aSlla  + saaE +YL++La++L+L++ lva+l++++
  VIMSS1138576 131 RRFIHRRLRELDLDCEAQALIAAELEAPQDAGRIARLARTPEEAAGIYAASLLAAGHGSAAEGSYLADLAARLKLEAGLVAHLHRRA 217
                   ************************************************************************************975 PP



Or compare VIMSS1138576 to CDD or PaperBLAST