PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS125558 to PF04391 (DUF533)

VIMSS125558 has 234 amino acids

Query:       DUF533  [M=179]
Accession:   PF04391.12
Description: Protein of unknown function (DUF533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.6e-60  188.1   1.8    6.6e-60  187.9   1.8    1.1  1  VIMSS125558  


Domain annotation for each sequence (and alignments):
>> VIMSS125558  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  187.9   1.8   6.6e-60   6.6e-60       4     179 .]      37     227 ..      34     227 .. 0.91

  Alignments for each domain:
  == domain 1  score: 187.9 bits;  conditional E-value: 6.6e-60
       DUF533   4 ggaaaggllglllGskkgrklgkkalklGglAalGglAykayqnwqanqq........eaapqsapk.........f.q.e.eeeekaelllrAmiaA 81 
                  +++a+g+++++llG+k+grkl+++a+ lGglAa++gl y+ay+n+q++++        +     +++         f   e  ++++a +l+rAmiaA
  VIMSS125558  37 NPLASGAIAAVLLGTKSGRKLAGNAAVLGGLAAIAGLGYQAYKNYQSGKEpvaepaprA-----PAQlpappadsgFaApEaLSDDFALVLVRAMIAA 129
                  67899******************************************999887444332.....33344445667753334699************** PP

       DUF533  82 AkADGhideeErqrIlqeleelgldaeekalledeLrkPldlqelaaavknpelaaevYlaSllaidedsaaEraYLdeLaqaLgLdpelvaeleaqv 179
                  A+ADGhid +Er rI+++l+ +gl+a++ a+le+eL +P+dl+++++a k++e+++e+Y+aS+lai++d +aEr YLd La +LgL+++lv+++ea+v
  VIMSS125558 130 ARADGHIDGTERGRIMDKLSVSGLSADAAAFLEAELVNPIDLDAIISAGKTEEERVEIYTASRLAIEPDGRAERGYLDLLAGRLGLADALVDHIEATV 227
                  ***********************************************************************************************986 PP



Or compare VIMSS125558 to CDD or PaperBLAST