PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS217181 to PF04391 (DUF533)

VIMSS217181 has 226 amino acids

Query:       DUF533  [M=179]
Accession:   PF04391.12
Description: Protein of unknown function (DUF533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      6e-72  227.1   4.6    8.2e-72  226.7   4.6    1.2  1  VIMSS217181  


Domain annotation for each sequence (and alignments):
>> VIMSS217181  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  226.7   4.6   8.2e-72   8.2e-72       2     179 .]      41     221 ..      40     221 .. 0.94

  Alignments for each domain:
  == domain 1  score: 226.7 bits;  conditional E-value: 8.2e-72
       DUF533   2 lgggaaaggllglllGskkgrklgkkalklGglAalGglAykayqnwqanqqeaapqsapk..fq.eeeeekaelllrAmiaAAkADGhideeErqrI 96 
                  +ggg++ gg+lglllGskk+rk+g+kal++GglAalG+lAykay nwqanq+ aa++++    ++ +++e++++++lrA++aAAk+DGhide+Er+ I
  VIMSS217181  41 AGGGLLGGGALGLLLGSKKARKYGGKALTYGGLAALGVLAYKAYGNWQANQRGAAAEPQTIdrLPpAQAEQHSQAVLRALVAAAKSDGHIDERERALI 138
                  57999*********************************************99666555222324335******************************* PP

       DUF533  97 lqeleelgldaeekalledeLrkPldlqelaaavknpelaaevYlaSllaidedsaaEraYLdeLaqaLgLdpelvaeleaqv 179
                  ++e+++l+ d+e +++l++eL+kPld++e+a+a+++pe+aae+YlaS++++d+++++EraYLdeLa++L+Ldp l++ele+qv
  VIMSS217181 139 EGEFTRLDSDRELQHWLHAELNKPLDPAEVARAAQTPEMAAEMYLASVMMVDQENFMERAYLDELARQLRLDPGLRQELESQV 221
                  ********************************************************************************997 PP



Or compare VIMSS217181 to CDD or PaperBLAST