PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS514501 to PF04391 (DUF533)

VIMSS514501 has 226 amino acids

Query:       DUF533  [M=179]
Accession:   PF04391.12
Description: Protein of unknown function (DUF533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.5e-65  204.2   8.2    8.9e-65  203.8   8.2    1.2  1  VIMSS514501  


Domain annotation for each sequence (and alignments):
>> VIMSS514501  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  203.8   8.2   8.9e-65   8.9e-65       2     179 .]      40     222 ..      39     222 .. 0.95

  Alignments for each domain:
  == domain 1  score: 203.8 bits;  conditional E-value: 8.9e-65
       DUF533   2 lgggaaaggllglllGskkgrklgkkalklGglAalGglAykayqnwqanqqeaapqsapk....fqe..eeeekaelllrAmiaAAkADGhideeEr 93 
                  lggga+ +g+lglllGskk+rk+g+k++ +Gg+AalG+lAy+ay ++q+nq+ +a+++ap+    + +   +e++++++l Ami AAkADGhi  +Er
  VIMSS514501  40 LGGGALGAGALGLLLGSKKARKIGGKVAMYGGMAALGALAYRAYDQYQRNQAGGAAAPAPQtldrL-PpaPAEQHSNAVLVAMIGAAKADGHIGPDER 136
                  6899************************************************99999988854433.1359*************************** PP

       DUF533  94 qrIlqeleelgldaeekalledeLrkPldlqelaaavknpelaaevYlaSllaidedsaaEraYLdeLaqaLgLdpelvaeleaqv 179
                  q +++el++l+ da ++a+le+eL++Pld++ +a+++++pe+ ae+YlaSll+ de+s++EraYLdeLa++L+L++el+++leaqv
  VIMSS514501 137 QLLETELAKLSGDAGDRAWLEAELARPLDPAVIAQQARTPEMGAEMYLASLLVADEQSFMERAYLDELARQLKLPAELKQQLEAQV 222
                  ************************************************************************************97 PP



Or compare VIMSS514501 to CDD or PaperBLAST