PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS53476 to PF04391 (DUF533)

VIMSS53476 has 214 amino acids

Query:       DUF533  [M=179]
Accession:   PF04391.12
Description: Protein of unknown function (DUF533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.5e-68  215.3   8.1      3e-68  215.1   8.1    1.1  1  VIMSS53476  


Domain annotation for each sequence (and alignments):
>> VIMSS53476  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  215.1   8.1     3e-68     3e-68       3     179 .]      37     211 ..      35     211 .. 0.94

  Alignments for each domain:
  == domain 1  score: 215.1 bits;  conditional E-value: 3e-68
      DUF533   3 gggaaaggllglllGskkgrklgkkalklGglAalGglAykayqnwqanqq.eaapqsapkfqeeeeekaelllrAmiaAAkADGhideeErqrIlqel 100
                 g+ga+ ggllg+llGskk+ k gk+alk+Gg+AalG+lAyk y++w+a+q+ ++ap++   f e++ +++ ++l+AmiaAAkADGh+de+E++rI q++
  VIMSS53476  37 GAGALGGGLLGMLLGSKKSAKWGKSALKVGGAAALGALAYKVYNDWNAKQNgQSAPTP---FDESNPRHELIILKAMIAAAKADGHVDEQEMARIQQAI 132
                 789********************************************99973333333...34699********************************* PP

      DUF533 101 eelgldaeekalledeLrkPldlqelaaavknpelaaevYlaSllaidedsaaEraYLdeLaqaLgLdpelvaeleaqv 179
                 eelg+d++ ++l+e+eLrkPld++e+a+ ++np++a+e+YlaSll+ de++++E+aYL+eLa++LgLd++lva+l+ qv
  VIMSS53476 133 EELGADNQVQQLVEQELRKPLDPSEIARFAQNPAQASELYLASLLIADEQNFMEKAYLNELAKQLGLDDQLVAQLNLQV 211
                 ***************************************************************************9775 PP



Or compare VIMSS53476 to CDD or PaperBLAST