PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5479938 to PF04391 (DUF533)

VIMSS5479938 has 234 amino acids

Query:       DUF533  [M=179]
Accession:   PF04391.12
Description: Protein of unknown function (DUF533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    7.6e-60  187.7   0.2      9e-60  187.4   0.2    1.1  1  VIMSS5479938  


Domain annotation for each sequence (and alignments):
>> VIMSS5479938  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  187.4   0.2     9e-60     9e-60       5     179 .]      38     224 ..      34     224 .. 0.90

  Alignments for each domain:
  == domain 1  score: 187.4 bits;  conditional E-value: 9e-60
        DUF533   5 gaaaggllglllGskkgrklgkkalklGglAalGglAykayqnwqanqq.......eaapqsapk.........f.q..eeeeekaelllrAmiaAA 82 
                   +  +g+l+++llG+k+gr+l+++alk+GglA+++gl y+ay+n+q++++               +         f +  + ++++a +l++AmiaAA
  VIMSS5479938  38 PWKTGALVSVLLGTKTGRSLAGGALKVGGLALVAGLGYRAYRNYQSGKApeelralP-------ElpappensgFdPatSLSNDFALTLIKAMIAAA 127
                   567899*****************************************9955444331.......222223356665553499*************** PP

        DUF533  83 kADGhideeErqrIlqeleelgldaeekalledeLrkPldlqelaaavknpelaaevYlaSllaidedsaaEraYLdeLaqaLgLdpelvaeleaqv 179
                   kADGhide Er++I+++l+  +l +e++a++++eL++P dl++l+aa++++e+++e+Y+aS+l+id+d++aEr YLd La +LgL++ l +++ea+v
  VIMSS5479938 128 KADGHIDEGERANIMEKLHVEELGDEAEAFIRAELDNPTDLDALVAAARTEEQKVELYTASRLTIDPDTRAERGYLDLLAGRLGLADGLIDHIEATV 224
                   **********************************************************************************************986 PP



Or compare VIMSS5479938 to CDD or PaperBLAST