PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS60161 to PF04391 (DUF533)

VIMSS60161 has 231 amino acids

Query:       DUF533  [M=179]
Accession:   PF04391.12
Description: Protein of unknown function (DUF533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    9.1e-71  223.3   6.2    1.4e-70  222.6   6.2    1.3  1  VIMSS60161  


Domain annotation for each sequence (and alignments):
>> VIMSS60161  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  222.6   6.2   1.4e-70   1.4e-70       2     179 .]      41     223 ..      40     223 .. 0.96

  Alignments for each domain:
  == domain 1  score: 222.6 bits;  conditional E-value: 1.4e-70
      DUF533   2 lgggaaaggllglllGskkgrklgkkalklGglAalGglAykayqnwqanqqeaapqsapk.fq...e.eeeekaelllrAmiaAAkADGhideeErqr 95 
                 +ggga+a+g++glllG+kk+rk+g+ka+++GglAalG++Aykay+nwq++q+ aapq++p+ +    e ++e +++++l+A++ AAkADGhide+Erq+
  VIMSS60161  41 AGGGALAAGAIGLLLGNKKARKFGGKAITYGGLAALGVIAYKAYNNWQQQQNGAAPQAQPQtVDrlpEaQAEVHSHAILQAIVGAAKADGHIDERERQM 139
                 689******************************************************999962334336****************************** PP

      DUF533  96 IlqeleelgldaeekalledeLrkPldlqelaaavknpelaaevYlaSllaidedsaaEraYLdeLaqaLgLdpelvaeleaqv 179
                 I++e+++l+ d+e + +le+eL+kPld++e+a+a+++pe aae+YlaSll++de+s++Er+YL+eLa++L+L+p+++ ele+q+
  VIMSS60161 140 IEGEVAKLTSDREVQGWLERELNKPLDPAEIARAASTPEIAAEMYLASLLMVDEESFMERSYLEELARQLRLEPSFKLELENQA 223
                 *********************************************************************************996 PP



Or compare VIMSS60161 to CDD or PaperBLAST