PaperBLAST – Find papers about a protein or its homologs

 

Align WP_042463606.1 to PF04391 (DUF533)

WP_042463606.1 has 237 amino acids

Query:       DUF533  [M=179]
Accession:   PF04391.12
Description: Protein of unknown function (DUF533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.8e-62  194.6   0.4    7.6e-62  194.2   0.4    1.2  1  WP_042463606.1  


Domain annotation for each sequence (and alignments):
>> WP_042463606.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  194.2   0.4   7.6e-62   7.6e-62       2     176 ..      36     225 ..      10     228 .. 0.91

  Alignments for each domain:
  == domain 1  score: 194.2 bits;  conditional E-value: 7.6e-62
          DUF533   2 lgggaaaggllglllGskkgrklgkkalklGglAalGglAykayqnwqanqqeaapqs......apk......f.qe...eeeekaelllrAmia 80 
                     l+ggaaaggl++lllGskk+rklg+kal++Gg+Aa+GglAyka+++wq+n++++++++      +        + +e   + +++  ++lrAmi 
  WP_042463606.1  36 LAGGAAAGGLVALLLGSKKARKLGGKALSYGGMAAVGGLAYKAWRDWQQNRPSGTEAEplhlppP-PadsgfdMaEErdsTGQDFRLAVLRAMIL 129
                     679*************************************************6666664555442.1467755222245689999********** PP

          DUF533  81 AAkADGhideeErqrIlqeleelgldaeekalledeLrkPldlqelaaavknpelaaevYlaSllaidedsaaEraYLdeLaqaLgLdpelvael 175
                     AA++DGhid eE++rI +++e+lgl aeeka l+d  ++P+d++e a+ +++ +++ae+YlaS+la+d+d++ Er+YLd+La++L L++ l+ +l
  WP_042463606.1 130 AANSDGHIDGEEHRRIRDRIEALGLGAEEKAALFDSFAAPADPAEAARPARTDAQRAELYLASVLAVDPDTPDERRYLDDLARHLALPEGLRGHL 224
                     ********************************************************************************************999 PP

          DUF533 176 e 176
                     +
  WP_042463606.1 225 D 225
                     7 PP



Or compare WP_042463606.1 to CDD or PaperBLAST