PaperBLAST – Find papers about a protein or its homologs

 

Align WP_057222430.1 to PF04391 (DUF533)

WP_057222430.1 has 219 amino acids

Query:       DUF533  [M=179]
Accession:   PF04391.12
Description: Protein of unknown function (DUF533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.8e-54  169.1   1.8    3.8e-54  169.1   1.8    1.4  2  WP_057222430.1  


Domain annotation for each sequence (and alignments):
>> WP_057222430.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.9   0.1      0.24      0.24     156     168 ..       3      15 ..       2      17 .. 0.86
   2 !  169.1   1.8   3.8e-54   3.8e-54       6     178 ..      32     209 ..      27     210 .. 0.91

  Alignments for each domain:
  == domain 1  score: -2.9 bits;  conditional E-value: 0.24
          DUF533 156 aYLdeLaqaLgLd 168
                     ++L++L++ LgL+
  WP_057222430.1   3 NWLHQLQSLLGLQ 15 
                     69******99997 PP

  == domain 2  score: 169.1 bits;  conditional E-value: 3.8e-54
          DUF533   6 aaaggllglllGskkgr....klgkkalklGglAalGglAykayqnwqanqqeaapqsapkf.qeeeeekaelllrAmiaAAkADGhideeErqr 95 
                     +a ggl+gll++sk++r    k+g++al +Gg A+ G++ +++yq+  + q+ +a++++ +  ++e + ++ +l++A++ AAk+DGhid++Er++
  WP_057222430.1  32 GAIGGLAGLLVASKSSRkllaKYGTSALLAGGGAVAGTVLWNKYQQKMRAQNTSAQAPETAAaPAEVDPRSVRLITALVFAAKSDGHIDDHERAN 126
                     689************88888899**********************655444444444433332469***************************** PP

          DUF533  96 IlqeleelgldaeekalledeLrkPldlqelaaavknpelaaevYlaSllaidedsaaEraYLdeLaqaLgLdpelvaeleaq 178
                     I+++l+++++d +++ l++++L++Pld+q+la+ + +p++a e+Y +S+++id d+++Er+YL++L +aL L+++++a++e++
  WP_057222430.1 127 IETQLRAANIDVQARVLIDQALAQPLDPQRLAEGIIDPQEALEIYYVSCAVIDIDHFMERSYLNALGDALALPKDVRADIEQD 209
                     *********************************************************************************97 PP



Or compare WP_057222430.1 to CDD or PaperBLAST