PaperBLAST – Find papers about a protein or its homologs

 

Align Q5F9H4 to PF04402 (SIMPL)

Q5F9H4 has 244 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    5.1e-25   75.2   1.9    5.7e-25   75.1   1.9    1.0  1  Q5F9H4    


Domain annotation for each sequence (and alignments):
>> Q5F9H4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   75.1   1.9   5.7e-25   5.7e-25       3     199 ..      39     241 ..      37     244 .] 0.76

  Alignments for each domain:
  == domain 1  score: 75.1 bits;  conditional E-value: 5.7e-25
   SIMPL   3 VtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldklgevldaavk 105
              + sa +eva+D+++ +++v +eg+d +++ ae  +k n+ +   k+ + k++ ++ s     p+y+y ng++  tg+e +++++ + rd+d+l++++++++ 
  Q5F9H4  39 FSESAGIEVAQDTMSARFQVAAEGRDKNAVNAEFVKKFNNFTRKSKNGSFKTELVSRSA---MPRYQYTNGRRIQTGWEERAEFKAEGRDFDALNRFIADVQT 138
             5668899*************************************997335665444444...4***********************************77755 PP

   SIMPL 106 aaneingvsfslsde..delrdeareeAvkdArakAealAkalgvklgkvvsisesgsnp.........yappapamaaaaaa....aasaatpfepgeievt 193
              a +++  +fs+s e  +e  d++ ++Av  ++a+Ae+lA  lg++  k+v+++ +++++         +++  +am++aa+      +saa+ +e    e++
  Q5F9H4 139 DA-SLEDTDFSVSRErrNEVIDQVSKDAVLRFKARAEKLAGVLGASGYKIVKLNFGQIGShiagdgavrAKM-LRAMPMAASVnmkgTDSAAPGVE----EIS 235
             33.699*******33346666677777**************9999999999999933333567787775333.33333333333555444444444....666 PP

   SIMPL 194 asVtvv 199
              s++ +
  Q5F9H4 236 ISINGT 241
             666544 PP



Or compare Q5F9H4 to CDD or PaperBLAST