PaperBLAST – Find papers about a protein or its homologs

 

Align Q9JZY4 to PF04402 (SIMPL)

Q9JZY4 has 234 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    9.5e-28   84.1   1.1    1.1e-27   83.9   1.1    1.0  1  Q9JZY4    


Domain annotation for each sequence (and alignments):
>> Q9JZY4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   83.9   1.1   1.1e-27   1.1e-27       3     199 ..      29     231 ..      27     234 .] 0.75

  Alignments for each domain:
  == domain 1  score: 83.9 bits;  conditional E-value: 1.1e-27
   SIMPL   3 VtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldklgevldaavk 105
              + sa veva+D+++ +++v++eg+d +++ ae  +k n+ +   k+ + k++ ++ s     p+y+y ng++  tg+e +++++v+ rd+d l+++++++++
  Q9JZY4  29 FSESAGVEVAQDTMSARFQVTAEGRDKNAVNAEFVKKFNKFIRKSKNGSFKTELVSRSA---MPRYQYTNGRRIQTGWEERAEFKVEGRDFDELNRFIADIQA 128
             566899**************************************997335665444444...4***********************************99977 PP

   SIMPL 106 a.aneingvsfslsde..delrdeareeAvkdArakAealAkalgvklgkvvsise....sgsnp........yappapamaaaaaa....aasaatpfepge 189
               a  +++ +f +s e  +e  d++ ++Av  ++a+Ae+lA  lg++  k+v+++     s   +        +++ +++++aa+      a+saa+ +e   
  Q9JZY4 129 DaA--LEYTDFHVSRErrNEVIDQVSKDAVLRFKARAEKLAGVLGASGYKIVKLNLghigS---HiagggaaqAKMLRAMPMAAS-VnmegADSAAPGVE--- 222
             544..89999999933346666677777**************9999888999999855542...144555553333333333333.24655555555544... PP

   SIMPL 190 ievtasVtvv 199
              e++ sV+ +
  Q9JZY4 223 -EISISVNGT 231
             .777777654 PP



Or compare Q9JZY4 to CDD or PaperBLAST