PaperBLAST – Find papers about a protein or its homologs

 

Align V5VB00 to PF04402 (SIMPL)

V5VB00 has 233 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    4.1e-29   88.6  10.1    4.8e-29   88.4  10.1    1.0  1  V5VB00    


Domain annotation for each sequence (and alignments):
>> V5VB00  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   88.4  10.1   4.8e-29   4.8e-29       1     197 [.      32     227 ..      32     230 .. 0.87

  Alignments for each domain:
  == domain 1  score: 88.4 bits;  conditional E-value: 4.8e-29
   SIMPL   1 ItVtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldklgevldaa 103
             ++V+++a+++v +D+++ tl +e ++k++ae+++++++ mn++l++ +k+  ++ +++t+  s++p y+  n+ nk++ ++ +++++++++d+++++++++++
  V5VB00  32 VNVQAEASRQVSNDEMHATLYIEKSNKQPAELSNQINQLMNQALATSRKY--PQVKVETGAQSTYPIYD--NDSNKLKEWRGRAEIRLESKDFKAASQLINEL 130
             689*******************************************8853..444689******99999..78888889**********************99 PP

   SIMPL 104 vka.aneingvsfslsde..delrdeareeAvkdArakAealAkalgvklgkvvsisesgsnpyappapamaaaaaa..aasaatpfepgeievtasVt 197
             +++ +   ++++fs+sde  ++ ++e++ eA k+++++A+ l +a +++  ++v+++ + +n+ ++p ++++ a++a  +a++a+++ +ge ++t++ +
  V5VB00 131 QQSfQ--TQSINFSVSDEqrKKVENELMVEASKNFQQRAQMLTQAWNKSQYSLVTLNLNTNNYFPQPVMRASLAKFAaaEAAPAQDMAAGESKITVNAN 227
             88655..689******776677788**********************98889999999767776666666666666688899999999**999999876 PP



Or compare V5VB00 to CDD or PaperBLAST