PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10252292 to PF04402 (SIMPL)

VIMSS10252292 has 243 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    6.9e-48  149.9   6.2      8e-48  149.7   6.2    1.0  1  VIMSS10252292  


Domain annotation for each sequence (and alignments):
>> VIMSS10252292  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  149.7   6.2     8e-48     8e-48       1     200 []      38     240 ..      38     240 .. 0.88

  Alignments for each domain:
  == domain 1  score: 149.7 bits;  conditional E-value: 8e-48
          SIMPL   1 ItVtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldkl 96 
                    I++tG+a+++vap+ a+ltl+++s++ + ++ak+++++ m+++++ l +lg+++kdi tss+s++p  +y++gk+  tgy++s+ +tvk+++ld +
  VIMSS10252292  38 INITGQASRSVAPNYAILTLGITSQNTNINAAKSNNDRIMSDLISRLANLGVAKKDIYTSSISINPTSDYQDGKRINTGYNVSNHVTVKINNLDNV 133
                    889********************************************************************************************* PP

          SIMPL  97 gevldaavka.aneingvsfslsdedelrdeareeAvkdArakAealAkalgvklgkvvsise....sgsnpyappapamaaaaaa...aasaatp 184
                    g+v+daav+a an in++sf+ + +++l+d + +eA+++ r+kAe++A+alg++lg+v+++s+    +     +++ +  ++++ +   a ++atp
  VIMSS10252292 134 GKVVDAAVSAgANDINNLSFQNDVSQQLSDSLTTEAIQNGRHKAEVIAEALGRTLGPVKTVSIstteT-----STMDSGYYRNPVMlkaALETATP 224
                    ********************87777*******************************996555522321.....22222233333335557899999 PP

          SIMPL 185 fepgeievtasVtvvf 200
                    +e g   v+ + ++++
  VIMSS10252292 225 VEKGSLIVSQDANITY 240
                    9999888888887776 PP



Or compare VIMSS10252292 to CDD or PaperBLAST