PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1750689 to PF04402 (SIMPL)

VIMSS1750689 has 243 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    6.4e-49  153.2   5.8    7.4e-49  153.0   5.8    1.0  1  VIMSS1750689  


Domain annotation for each sequence (and alignments):
>> VIMSS1750689  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  153.0   5.8   7.4e-49   7.4e-49       1     200 []      45     240 ..      45     240 .. 0.93

  Alignments for each domain:
  == domain 1  score: 153.0 bits;  conditional E-value: 7.4e-49
         SIMPL   1 ItVtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldklg 97 
                   +tV G+++v+ +pD+ t ++  e  ++d+++a ++ +++ +av++al ++gi++kdi+t+++s++p+   ++  n+itgy+as++++vk+rdld+++
  VIMSS1750689  45 VTVVGEGQVQGVPDTLTTNVAMEFIAADVSSALNQSSQRQQAVIDALVAAGIDRKDISTTQVSVQPQFGTDGASNTITGYRASNTIDVKIRDLDTAS 141
                   79**********************************************99*********************************************** PP

         SIMPL  98 evldaavka.an..eingvsfslsdedelrdeareeAvkdArakAealAkalgvklgkvvsise.sgsnpyappapamaaaaaaaasaatpfepgei 190
                   + l+ +++  ++  +in+v fs++d+++l ++ar+eA +dA+++A+++A+ +g++lg+v+sise sgs+   pp+p+++a     a++a p+epg++
  VIMSS1750689 142 QTLTLIAETgGDatRINSVAFSIEDDSDLVRDARAEAFNDAKNRAQQYADLSGLSLGEVISISEeSGST---PPRPMPRA-----AMEAVPLEPGQQ 230
                   ***999999988768*************************************************43333...33333333.....346899****** PP

         SIMPL 191 evtasVtvvf 200
                    v+ sVtv +
  VIMSS1750689 231 AVNFSVTVIW 240
                   ********87 PP



Or compare VIMSS1750689 to CDD or PaperBLAST