PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1791854 to PF04402 (SIMPL)

VIMSS1791854 has 234 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.7e-27   83.3   1.6    1.9e-27   83.1   1.6    1.0  1  VIMSS1791854  


Domain annotation for each sequence (and alignments):
>> VIMSS1791854  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   83.1   1.6   1.9e-27   1.9e-27       3     199 ..      29     231 ..      27     234 .] 0.75

  Alignments for each domain:
  == domain 1  score: 83.1 bits;  conditional E-value: 1.9e-27
         SIMPL   3 VtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldklgev 99 
                    + sa veva+D+++ +++v +eg+d +++ ae  +k n+    lk+ + k++ ++ s     p+y+y ng++  tg+e +++++v+ rd+d+l+++
  VIMSS1791854  29 FSESAGVEVAQDTMSARFQVAAEGRDKNAVNAEFVKKFNSFNRKLKNGSFKTELVSRSA---MPRYQYTNGRRIQTGWEERAEFKVEGRDFDALNRF 122
                   566899****************************************8445665444444...4********************************** PP

         SIMPL 100 ldaavkaaneingvsfslsde..delrdeareeAvkdArakAealAkalgvklgkvvsise....sgsnp........yappapamaaaaaa....a 178
                   +++++  a ++++ +fs+s e  +e  d++ ++A+  ++++Ae+lA  lg++  k+v+++     s   +        +++ +++++aa+      a
  VIMSS1791854 123 IADVQTDA-SLEYTDFSVSRErrNEVIDQVSKDAILRFKTRAEKLAGILGASGYKIVKLNLghigS---HiagggaaqAKMLRAMPMAAS-VnmegA 214
                   *7775533.69999*****33346666677777**************9998888888888855541...144454454333333333333.246665 PP

         SIMPL 179 asaatpfepgeievtasVtvv 199
                   +saa+ +e    e++ sV+ +
  VIMSS1791854 215 DSAAQGVE----EISISVNGT 231
                   55555555....666666654 PP



Or compare VIMSS1791854 to CDD or PaperBLAST