PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS242374 to PF04402 (SIMPL)

VIMSS242374 has 197 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.3e-38  117.4   0.0    6.9e-38  117.2   0.0    1.0  1  VIMSS242374  


Domain annotation for each sequence (and alignments):
>> VIMSS242374  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  117.2   0.0   6.9e-38   6.9e-38       5     197 ..       3     190 ..       1     193 [. 0.92

  Alignments for each domain:
  == domain 1  score: 117.2 bits;  conditional E-value: 6.9e-38
        SIMPL   5 GsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldklgevlda 102
                  Gs+ v+++p +a+++  v + ++++++a +++ e++++++e l+++g+++ +++ s+l l++ey+   +++++ gy++++s+ v++  ld+l++++++
  VIMSS242374   3 GSGAVRAEPSLARVRPAVDVLEPSPEQAFQRAGEAVARLREVLRRHGVPDASVSGSRLGLSSEYDGHARGRTLLGYRCQASYAVETGALDDLERLIAD 100
                  99************************************************99********************************************** PP

        SIMPL 103 avka.aneingvsfslsdedelrdeareeAvkdArakAealAkalgvklgkvvsisesgsnpyappapamaaaaaaaasaatpfepgeievtasVt 197
                  +v+a a +i+gv+f+++d+ +l dear++Av++Ar+kA+++A+a++++lg+v+ i++ +++p       +a +a+aa  ++ ++ pg +ev+a+V 
  VIMSS242374 101 VVDAgAHRIDGVEFDVRDRPALLDEARRRAVAAARRKAQVYAEAADARLGPVLHIQDVEAEPV------AAFRASAAGGPPGALAPGAVEVSARVV 190
                  ****999*************************************************9433332......2222223578899999*********96 PP



Or compare VIMSS242374 to CDD or PaperBLAST