PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3629783 to PF04402 (SIMPL)

VIMSS3629783 has 216 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.1e-29   89.0  10.1    3.7e-29   88.7  10.1    1.0  1  VIMSS3629783  


Domain annotation for each sequence (and alignments):
>> VIMSS3629783  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   88.7  10.1   3.7e-29   3.7e-29       1     197 [.      15     210 ..      15     213 .. 0.87

  Alignments for each domain:
  == domain 1  score: 88.7 bits;  conditional E-value: 3.7e-29
         SIMPL   1 ItVtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldklg 97 
                   ++V+++a+++v +D+++ tl +e ++k++ae+++++++ mn++l++ +k+  ++ +++t+  s++p y+  n+ nk++ ++ +++++++++d+++++
  VIMSS3629783  15 VNVQAEASRQVSNDEMHATLYIEKSNKQPAELSNQINQLMNQALATSRKY--PQVKVETGAQSTYPIYD--NDSNKLKEWRGRAEIRLESKDFKAAS 107
                   689*******************************************8853..444689******99999..78888889****************** PP

         SIMPL  98 evldaavka.aneingvsfslsde..delrdeareeAvkdArakAealAkalgvklgkvvsisesgsnpyappapamaaaaaa..aasaatpfepge 189
                   +++++++++ +   ++++fs+sde  ++ ++e++ eA k+++++A+ l +a +++  ++v+++ + +n+ ++p ++++ a++a  +a++a+++ +ge
  VIMSS3629783 108 QLINELQQSfQ--TQSINFSVSDEqrKKVENELMVEASKNFQQRAQMLTQAWNKSQYSLVTLNLNTNNYFPQPVMRASLAKFAaaEAAPAQDMAAGE 202
                   ****9988655..689******776677788**********************98889999999767776666666666666688899999999**9 PP

         SIMPL 190 ievtasVt 197
                    ++t++ +
  VIMSS3629783 203 SKITVNAN 210
                   99999876 PP



Or compare VIMSS3629783 to CDD or PaperBLAST