PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5055392 to PF04402 (SIMPL)

VIMSS5055392 has 190 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    6.4e-49  153.2   0.6    7.2e-49  153.1   0.6    1.0  1  VIMSS5055392  


Domain annotation for each sequence (and alignments):
>> VIMSS5055392  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  153.1   0.6   7.2e-49   7.2e-49      15     200 .]       1     186 [.       1     186 [. 0.93

  Alignments for each domain:
  == domain 1  score: 153.1 bits;  conditional E-value: 7.2e-49
         SIMPL  15 qatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysy...engknkitgyeasqsltvkfrdldklgevldaavka.a 107
                   +at++l+v+ e++ a +a +  +++++avl++l+++gi+ +d+qt+++sl+p+++    en++++itg++a+++lt+++rdld+lg +ld++v+  a
  VIMSS5055392   1 MATINLGVTNEARLAGDALRLTSDAVAAVLAQLNEAGIAPRDMQTQGVSLQPVWNRrnpENETPRITGFVARNTLTIRVRDLDTLGGILDRVVQDgA 97 
                   69********************************99************************************************************* PP

         SIMPL 108 neingvsfslsdedelrdeareeAvkdArakAealAkalgvklgkvvsisesgsnpyappapamaaaaaaaasaatpfepgeievtasVtvvf 200
                   n+ ng++fs++d++++ ++ar++AvkdA+akAe+lA+a+gv lg+v+sisesg++++ p    m+++a+a  +++ p+ +ge+++ta+V++vf
  VIMSS5055392  98 NTFNGLQFSIQDPEPAIAAARQDAVKDAIAKAEQLAEAAGVALGPVQSISESGGGGR-PV---MMEMASARMASDVPVAAGEVSLTARVSMVF 186
                   ***************************************************655553.33...333333456899999*************98 PP



Or compare VIMSS5055392 to CDD or PaperBLAST