PaperBLAST – Find papers about a protein or its homologs

 

Align WP_009046973.1 to PF04402 (SIMPL)

WP_009046973.1 has 238 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-31   96.9   0.7    1.4e-31   96.6   0.7    1.1  1  WP_009046973.1  


Domain annotation for each sequence (and alignments):
>> WP_009046973.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   96.6   0.7   1.4e-31   1.4e-31       1     196 [.      34     229 ..      34     233 .. 0.83

  Alignments for each domain:
  == domain 1  score: 96.6 bits;  conditional E-value: 1.4e-31
           SIMPL   1 ItVtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldk 95 
                     I++ ++ + eva D++++tl  es+++d+a+++ae++++mn++l ++++  +k+  ++ +s + +p y+  ++++kitg++ +++l+++++d+ +
  WP_009046973.1  34 ISLRAEVSQEVARDLMIVTLYSESQNADPAKLAAEITTTMNKALGQARQ--VKDITLRQGSRNSYPIYD--TKGQKITGWRERAELRLESSDFAA 124
                     788999****************************************994..544445888888888888..8********************999 PP

           SIMPL  96 lgevldaavkaan.eingvsfslsde..delrdeareeAvkdArakAealAkalgvklgkvvsisesgsnpyappapamaaaaaa...aasaatp 184
                     l+++ ++++   + +++g++f ++d+  ++ +d++++eAv++++a+A+   +alg k  k+v+++ +++++ +p+ + +++++aa   aa  +++
  WP_009046973.1 125 LSKLTGELLT--DlKMGGMDFAIADPtrKASEDKLLKEAVDAFKARAQLTTEALGGKGYKIVNLNLNSNGYPQPYLRGQMMMKAAgmdAAPVTPE 217
                     9999988866..33699*******888677799**********************9999**9999943333333333333333334569999999 PP

           SIMPL 185 fepgeievtasV 196
                     +e+g+ +v+++ 
  WP_009046973.1 218 VEAGTSQVSMTA 229
                     9***99999885 PP



Or compare WP_009046973.1 to CDD or PaperBLAST