PaperBLAST – Find papers about a protein or its homologs

 

Align NP_075736.1 to PF04430 (DUF498)

NP_075736.1 has 185 amino acids

Query:       DUF498  [M=109]
Accession:   PF04430.18
Description: Protein of unknown function (DUF498/DUF598)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.6e-40  122.7   0.0    7.8e-40  121.6   0.0    1.5  2  NP_075736.1  


Domain annotation for each sequence (and alignments):
>> NP_075736.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.2   0.0      0.22      0.22      28      46 ..      24      43 ..      18      51 .. 0.67
   2 !  121.6   0.0   7.8e-40   7.8e-40       1     109 []      61     169 ..      61     169 .. 0.98

  Alignments for each domain:
  == domain 1  score: -2.2 bits;  conditional E-value: 0.22
       DUF498 28 fawev.akaedlteeslall 46
                 + w++ +++++l++++ +l+
  NP_075736.1 24 RLWRNpRRGHRLSPADDELY 43
                 67876345999999887776 PP

  == domain 2  score: 121.6 bits;  conditional E-value: 7.8e-40
       DUF498   1 idgygeggfrvngkkyegsllvlpgevfawevakaedlteeslallellepkpevlilGtGarlrflppelrealkergigvevmdtraAcrtyNvla 98 
                  id+y+++gf++ g+++ g++++lp++v +w+v +++d+tees++l+ +lep++e++++GtG+++ +l+p++++a+++rgi+vev+dt++Ac+t+N+l 
  NP_075736.1  61 IDSYSSRGFTICGNRVFGPCVLLPQTVVQWNVGSHQDITEESFSLFWMLEPRIEIVVVGTGNKTERLHPQVLQAMRQRGIAVEVQDTPNACATFNFLC 158
                  89****************************9877**************************************************************** PP

       DUF498  99 segrrvaaaLi 109
                  +egr  +aaLi
  NP_075736.1 159 HEGRVTGAALI 169
                  *********98 PP



Or compare NP_075736.1 to CDD or PaperBLAST