WP_025330622.1 has 125 amino acids
Query: DUF498 [M=109]
Accession: PF04430.18
Description: Protein of unknown function (DUF498/DUF598)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.1e-34 102.4 0.0 8e-34 102.2 0.0 1.0 1 WP_025330622.1
Domain annotation for each sequence (and alignments):
>> WP_025330622.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 102.2 0.0 8e-34 8e-34 1 108 [. 14 119 .. 14 120 .. 0.96
Alignments for each domain:
== domain 1 score: 102.2 bits; conditional E-value: 8e-34
DUF498 1 idgygeggfrvngkkyegsllvlpgevfawevakaedlteeslallellepkpevlilGtGarlrflppelrealkergigvevmdtraAcrtyN 95
i++++ g+++vng++y++++++++++v+ +++ a++lt +++ + l+ kpev+++GtG++++f++p+l+ +l ++gigve m+t+aAcrt+
WP_025330622.1 14 IEEVDTGKITVNGRQYTQPVCITADKVLTLDKQAASELTIDDFTQA--LQFKPEVILIGTGNHHVFIHPRLTSQLVAKGIGVESMSTAAACRTFM 106
78899**********************9998666***********9..8999******************************************* PP
DUF498 96 vlasegrrvaaaL 108
vl segr+v+a+L
WP_025330622.1 107 VLRSEGRSVWAWL 119
***********98 PP
Or compare WP_025330622.1 to CDD or PaperBLAST