VIMSS818287 has 129 amino acids
Query: DUF559 [M=109]
Accession: PF04480.16
Description: Protein of unknown function (DUF559)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.6e-53 164.4 0.1 4.1e-53 164.2 0.1 1.0 1 VIMSS818287
Domain annotation for each sequence (and alignments):
>> VIMSS818287
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 164.2 0.1 4.1e-53 4.1e-53 3 109 .] 15 121 .. 13 121 .. 0.98
Alignments for each domain:
== domain 1 score: 164.2 bits; conditional E-value: 4.1e-53
DUF559 3 lkanarklRreqteaekkLWrllrnrrlsglkfrRqkpigsYivDfvclkaklivelDGaqhdeeeeyDaeRtelLeslGftvlRfkndevlknieev 100
l+++a+++R+e++eae+kLW++lr+ rl+g+kfrRq+p+g+YivDf+c++ klive+DG+qh+e++ yD++Rt +L+slGftvlRf+n+e+l+++++v
VIMSS818287 15 LRQRAKAMRQEMSEAEAKLWQHLRAGRLNGYKFRRQQPMGNYIVDFMCVTPKLIVEADGGQHAEQAVYDHARTVYLNSLGFTVLRFWNHEILQQTNDV 112
6899********************************************************************************************** PP
DUF559 101 leeilkale 109
l+eil++l+
VIMSS818287 113 LAEILRVLQ 121
*****9985 PP
Or compare VIMSS818287 to CDD or PaperBLAST