PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS99644 to PF04480 (DUF559)

VIMSS99644 has 177 amino acids

Query:       DUF559  [M=109]
Accession:   PF04480.16
Description: Protein of unknown function (DUF559)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.7e-46  142.9   0.2    2.1e-46  142.6   0.2    1.1  1  VIMSS99644  


Domain annotation for each sequence (and alignments):
>> VIMSS99644  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  142.6   0.2   2.1e-46   2.1e-46       2     108 ..      57     160 ..      56     161 .. 0.97

  Alignments for each domain:
  == domain 1  score: 142.6 bits;  conditional E-value: 2.1e-46
      DUF559   2 klkanarklRreqteaekkLWrllrnrrlsglkfrRqkpigsYivDfvclkaklivelDGaqhdeeeeyDaeRtelLeslGftvlRfkndevlknieev 100
                 ++ ++ar+lRr+++++e++LWrllr+rrl+glkfrRq pig+Y+vDf+cl+++live+DG +hd  e++Da+R+++L+ +Gf+vlRfknde+ +n+++v
  VIMSS99644  57 RQLDFARRLRRDAPAMERVLWRLLRDRRLDGLKFRRQLPIGRYVVDFACLRHRLIVEADGPYHD--EARDAQRDAWLAGQGFRVLRFKNDEL-NNPDRV 152
                 56789***********************************************************..899**********************9.9***** PP

      DUF559 101 leeilkal 108
                 l  il+a+
  VIMSS99644 153 LGLILEAC 160
                 ****9987 PP



Or compare VIMSS99644 to CDD or PaperBLAST