VIMSS10090761 has 414 amino acids
Query: DUF573 [M=95]
Accession: PF04504.17
Description: Protein of unknown function, DUF573
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.4e-28 85.8 1.6 3e-28 84.7 1.6 1.6 1 VIMSS10090761
Domain annotation for each sequence (and alignments):
>> VIMSS10090761
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 84.7 1.6 3e-28 3e-28 2 95 .] 60 153 .. 59 153 .. 0.97
Alignments for each domain:
== domain 1 score: 84.7 bits; conditional E-value: 3e-28
DUF573 2 qrlWseeDEielLqglldfksktgkspksdldafyeavksslssdvskeqlveKlrrLkkkyeaivskikkgkdpsfkkphdrklfelskkiWg 95
+ +Ws++DE+++L g++d++++t+ s sd+da+y+++k++++ ++sk ql++K++++k+k++ ++ ++++g++ sf++++d ++f+ls iW+
VIMSS10090761 60 KMNWSKNDELVILGGIVDYENETKLSYRSDWDALYRYIKDCVEAKFSKIQLINKVKNMKRKFTYNQGRSNHGEQLSFTNTDDDEIFKLSLIIWD 153
579**********************866*****************************************************************6 PP
Or compare VIMSS10090761 to CDD or PaperBLAST