Q8W4Z5 has 207 amino acids
Query: CASP_dom [M=151] Accession: PF04535.16 Description: Casparian strip membrane protein domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-44 136.1 9.6 6.1e-44 135.6 9.6 1.2 1 Q8W4Z5 Domain annotation for each sequence (and alignments): >> Q8W4Z5 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 135.6 9.6 6.1e-44 6.1e-44 2 151 .] 33 173 .. 32 173 .. 0.97 Alignments for each domain: == domain 1 score: 135.6 bits; conditional E-value: 6.1e-44 CASP_dom 2 rklrlaelvLRllalvlalaaavvmatnkqtkevfkiqkkakfsdlpafrylvvanaiaavYsllqlvlsvvslvrkkserskalalllfilDqvlaylll 102 +++r+ae +LRl+ ++l +aa+vvm n+q++++ +++++sdl afrylv+an+i+a+Ysll++++++v ++++ +a+++f+lDq+l+y++l Q8W4Z5 33 TSMRTAETMLRLVPMALGVAALVVMLKNSQSNDF----GSVSYSDLGAFRYLVHANGICAGYSLLSAIIAAVPS-----PSTMPRAWTFFLLDQILTYVIL 124 6799****************************99....8********************************977.....9999****************** PP CASP_dom 103 sAasAaaavvylakkgnseaqWlkiCnqfgkFcnrvaaavalsflafll 151 Aa+ +++v yla+kg+s+++W+++C +f Fc+++++av+++f+a+++ Q8W4Z5 125 GAAAVSTEVLYLANKGDSAITWSAACGTFAGFCHKATIAVVITFVAVIC 173 **********************************************997 PP
Or compare Q8W4Z5 to CDD or PaperBLAST