XP_015638091.1 has 162 amino acids
Query: CASP_dom [M=151] Accession: PF04535.16 Description: Casparian strip membrane protein domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-40 123.6 16.9 4e-40 123.2 16.9 1.2 1 XP_015638091.1 Domain annotation for each sequence (and alignments): >> XP_015638091.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 123.2 16.9 4e-40 4e-40 4 150 .. 5 141 .. 2 142 .. 0.95 Alignments for each domain: == domain 1 score: 123.2 bits; conditional E-value: 4e-40 CASP_dom 4 lrlaelvLRllalvlalaaavvmatnkqtkevfkiqkkakfsdlpafrylvvanaiaavYsllqlvlsvvslvrkkserskalalllfilDqvla 98 rl++ vLRl+a+++a++aavvm+t+++t+++f iq++ak+s++p+f+++vva a+aa+Ysll l++ + s al l ++ D+vl XP_015638091.1 5 HRLMNAVLRLAAAAAAATAAVVMVTSRETTSFFGIQMEAKYSYTPSFIFFVVAYAVAAAYSLLVLAVPAGS----------ALSRLALTTDVVLG 89 68899**************************************************************9843..........46778999****** PP CASP_dom 99 ylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcnrvaaavalsflafl 150 ++l+ A+++a a++++ak+gns+a+Wl++C q + +cn+v aa+++ f+a++ XP_015638091.1 90 MVLAGAVASAGAISDIAKNGNSHAGWLPVCGQIHAYCNHVMAALIAGFVALA 141 *************************************************986 PP
Or compare XP_015638091.1 to CDD or PaperBLAST