PaperBLAST – Find papers about a protein or its homologs

 

Align Q599J2 to PF04577 (DUF563)

Q599J2 has 468 amino acids

Query:       DUF563  [M=209]
Accession:   PF04577.14
Description: Protein of unknown function (DUF563)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.2e-26   80.3   0.1    1.9e-26   79.6   0.1    1.3  1  Q599J2    


Domain annotation for each sequence (and alignments):
>> Q599J2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   79.6   0.1   1.9e-26   1.9e-26       3     205 ..     193     443 ..     191     447 .. 0.79

  Alignments for each domain:
  == domain 1  score: 79.6 bits;  conditional E-value: 1.9e-26
  DUF563   3 ygHwlvdvlprl.llleqlvlddddrilvpalaspqpfqrellkllgirpekrikveldepvhveklivpvpprssggfqgallp.................. 86 
              +H ++d+ + + +    +++ +   i+v+  +  q  ++ ++k+  +    r+  e + +v+++++i++  ++  + f+g  ++                  
  Q599J2 193 LFHTITDWYSAYvASRVTDLPYRPHLIFVDVDDKFQTPLEGTWKA--LFSSVRYAKEFSGSVCLRHAILVPLGYETALFKGLTEKincqgasahdlwqnpddq 293
             459999999999555555566666555544433555556678844..345799999999******99999999966666666666666777777777777888 PP

  DUF563  87 ......klrdrlrerlnlekr....kkp...trvlyisR.....lkag....sRrilNeeevl........kllpkrgfevvd..peslsfeeqiklfssakv 157
                   ++ +++r++++ + +     kp   ++vl++ R     ++        r++Ne+ev+        ++l + +++ ++  ++++s++eq++ +++a+v
  Q599J2 294 ktarlsEFGEMIRAAFDFPVSrhraEKPfsgHNVLFVRRedylaHPRHvgkvESRLSNEQEVFdslqtwvsNHL-ECKVNLINglFAHMSMKEQVRAVQDASV 395
             999999**************988885558888999****7776633337789**********977766663333.3557788888****************** PP

  DUF563 158 ivgphGsgltnliFmppgttvielvppnrldnsfenlaallglkyayv 205
             i+g hG+glt+++ + p+t ++e++++  ++++f+ +a+++gl+y+++
  Q599J2 396 IIGAHGAGLTHIVSATPKTIILEIISSYFRRPHFQLIAEWKGLEYHAI 443
             ************************988888888*************98 PP



Or compare Q599J2 to CDD or PaperBLAST