PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8BYW9 to PF04577 (DUF563)

SwissProt::Q8BYW9 has 527 amino acids

Query:       DUF563  [M=209]
Accession:   PF04577.14
Description: Protein of unknown function (DUF563)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.8e-32   99.3   0.2    2.7e-32   98.7   0.2    1.2  1  SwissProt::Q8BYW9  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8BYW9  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   98.7   0.2   2.7e-32   2.7e-32       1     207 [.     245     470 ..     245     472 .. 0.76

  Alignments for each domain:
  == domain 1  score: 98.7 bits;  conditional E-value: 2.7e-32
             DUF563   1 nnygHwlvdvlprlllleqlvlddddrilvpalaspq...pfqrellkllgirpekrikve.ld.epvhve............klivpvppr 75 
                        n+y H ++d+l  +l+       ++d+++v    s++   + + +++k+  ++  + i+++ +d ++v+++             l + +p+ 
  SwissProt::Q8BYW9 245 NMY-HHFCDFLNLYLTQHVNNSFSTDVYIVMWDTSTYgygDLFSDTWKA--FTDYDVIHLKtYDsKKVCFKeavfsllprmryGLFYNTPLI 333
                        689.******8877776666666667777554334445678888***55..44455555553333777777555555555555555555555 PP

             DUF563  76 ssggfqgallpklrdrlrerlnlekrkkp....trvlyisRlkagsRrilNeeevl...kllpkrgfevvd..peslsfeeqiklfssakvi 158
                         sg+ + +l+++++++++ rln+++  +p     rv+++ R ++ +R+ilN++e++   k +  ++++vvd    +l f +q+++ ++++++
  SwissProt::Q8BYW9 334 -SGCQNTGLFRAFSQHVLHRLNITQE-GPkdgkVRVTILAR-STEYRKILNQDELVnalKTVSTFEVRVVDykYRELGFLDQLRITHNTDIF 422
                        .6666666667**************6.4445669*******.99***********944455557778899966669**************** PP

             DUF563 159 vgphGsgltnliFmppgttvielvppnrldnsfenlaallglkyayvlg 207
                        +g+hG+glt+l+F+p  ++v el      ++++  la+l+g++y+ ++ 
  SwissProt::Q8BYW9 423 IGMHGAGLTHLLFLPDWAAVFEL-YNCEDERCYLDLARLRGIHYITWRK 470
                        **************999******.55566667*************9975 PP



Or compare SwissProt::Q8BYW9 to CDD or PaperBLAST