PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3597289 to PF04577 (DUF563)

VIMSS3597289 has 188 amino acids

Query:       DUF563  [M=209]
Accession:   PF04577.14
Description: Protein of unknown function (DUF563)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
      2e-36  112.2   0.1    2.2e-36  112.1   0.1    1.0  1  VIMSS3597289  


Domain annotation for each sequence (and alignments):
>> VIMSS3597289  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  112.1   0.1   2.2e-36   2.2e-36      11     191 ..       1     181 [.       1     188 [] 0.82

  Alignments for each domain:
  == domain 1  score: 112.1 bits;  conditional E-value: 2.2e-36
        DUF563  11 lprlllleqlvlddddrilvpalaspqpfqr...ell.kllgirpekrikveldepvhveklivpvpprssggfqgallpklrdrlrerlnlekrkk 103
                   +prl++l++  l+ d r  +++    +++q    e++ ++l+i+++k  +v +d  +++++livp+ p+  +    +l+ +l + lr+ +  ++ +k
  VIMSS3597289   1 MPRLIILKESALEYD-RTYINN--LKYSWQIkslEIVlNYLNIPEDKLFVVNSDCIIQATRLIVPSVPF-IPVKGTPLPLWLKKDLRNIFIKDN-SK 92 
                   689988888888888.556666..6677777334333366***77777777789999************.7777778888**************.77 PP

        DUF563 104 ptrvlyisRlkagsRrilNeeevlkllpkrgfevvdpeslsf.eeqiklfssakvivgphGsgltnliFmppgttvielvppnrldns...f 191
                    + ++yisR+ a+ R i+Neee++++ ++ g++v++++ lsf  eq++lf++ak+ivg+hGsg++n iF+ p++tv+e+   ++ ++s   +
  VIMSS3597289  93 AYDKIYISRKYASTRTIVNEEELIEKIERSGLKVIYLA-LSFpYEQAQLFNKAKIIVGSHGSGFANFIFAVPKCTVVEI--DHGTTPSrsfY 181
                   77888*********************************.55427**************************999******..44444443444 PP



Or compare VIMSS3597289 to CDD or PaperBLAST