PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6591791 to PF04577 (DUF563)

VIMSS6591791 has 561 amino acids

Query:       DUF563  [M=209]
Accession:   PF04577.14
Description: Protein of unknown function (DUF563)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    5.4e-24   71.6   0.0    3.7e-23   68.9   0.0    2.1  2  VIMSS6591791  


Domain annotation for each sequence (and alignments):
>> VIMSS6591791  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.2   0.0     0.053     0.053      38     100 ..     202     268 ..     182     302 .. 0.47
   2 !   68.9   0.0   3.7e-23   3.7e-23      88     205 ..     377     503 ..     363     507 .. 0.83

  Alignments for each domain:
  == domain 1  score: -0.2 bits;  conditional E-value: 0.053
        DUF563  38 pfqrellkllgirpekrikveldepvhve.........klivpvpprssggfqgallpklrdrlrerlnlek 100
                   +f++ell  lg+    r +  ld+++ ++         + i+p+ + ++ +  + + + l+++++ ++  e 
  VIMSS6591791 202 HFAAELL--LGL---WRTYSSLDPTISAQgvthlpspsRMIFPHVSAGKWNDYAKMNSYLSRAIFPSMSYEY 268
                   4444555..555...333344444444444333444444444444444444444444444444444444444 PP

  == domain 2  score: 68.9 bits;  conditional E-value: 3.7e-23
        DUF563  88 lrdrlrerlnlekrkkptrvlyisRlkagsRrilNee..evl....kllpkrgfe..vvdpeslsfeeqiklfssakvivgphGsgltnliFm...p 173
                   +r+++++  + e  +kp  ++y+sR++ g+R +  e    ++    +l +k+g+e  +v++++l+ eeqi+l + + +++g+hG glt+l++m   +
  VIMSS6591791 377 VREKIMKEKEAEA-SKP-VITYVSRQDWGRRMLKKEShdSLVkelhDLEEKYGWEvnIVSMDKLTREEQIRLSARTTIMMGVHGNGLTHLLWMngqN 471
                   5555555555555.899.*******88888888887765444433255558888877************************************6544 PP

        DUF563 174 pgttvielvppnrldnsfenlaallglkyayv 205
                   p++tvie+++p+++   +e  +++lg+k+++v
  VIMSS6591791 472 PRATVIEFFFPGGFAEDYEFTSRALGIKHYGV 503
                   58***************************987 PP



Or compare VIMSS6591791 to CDD or PaperBLAST