PaperBLAST – Find papers about a protein or its homologs

 

Align XP_001303824.1 to PF04577 (DUF563)

XP_001303824.1 has 358 amino acids

Query:       DUF563  [M=209]
Accession:   PF04577.14
Description: Protein of unknown function (DUF563)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.3e-41  127.5   0.8    5.8e-41  127.0   0.8    1.2  1  XP_001303824.1  


Domain annotation for each sequence (and alignments):
>> XP_001303824.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  127.0   0.8   5.8e-41   5.8e-41       2     208 ..      74     279 ..      73     280 .. 0.94

  Alignments for each domain:
  == domain 1  score: 127.0 bits;  conditional E-value: 5.8e-41
          DUF563   2 nygHwlvdvlprlllleqlvlddddrilvpalaspqpfqrellkllgirpekrikveldepvhveklivpvpprssggfqgallpklrdrlrerl 96 
                      +gH + d+++ l +l++ v+++++ i++p+  s  + ++++l+++g+ +    + + +++++v++l+v+++   +++ ++++++ +r++++er+
  XP_001303824.1  74 EWGHTIDDFISGLTYLPESVQKQEFTIAIPP--SAGKDLQDWLQACGF-KVHLFDGYANQHIFVRQLYVVSHMSKAHRAFAGGYSYMRRKMFERF 165
                     59*****************************..7777888********.99999999************************************** PP

          DUF563  97 nlekrkkptrvlyisRlkagsRrilNeeevl.......kllpkrgfevvdpeslsfeeqiklfssakvivgphGsgltnliFmppgttvielvpp 184
                     nl++ ++ tr++ ++R  + +R++ N++ev+       k+ ++ ++ev+ ++++++ eq+kl+ ++kv++++ Gs+l+n++Fm++ t++i+l +p
  XP_001303824.1 166 NLSQ-INSTRFCAMNR--DTRRYLGNFNEVVdglnkyvKIDDGKTWEVI-HNQHNIYEQVKLWPTIKVLFTVGGSQLFNCMFMHNSTGLIVL-FP 255
                     ****.7888*******..9***********999986666666777****.577***************************************.99 PP

          DUF563 185 nrldnsfenlaallglkyayvlge 208
                     n++ + ++++a + ++  a+++++
  XP_001303824.1 256 NNVLTEQMSIAFQNHMFSAVIYHK 279
                     ***************999999986 PP



Or compare XP_001303824.1 to CDD or PaperBLAST