PaperBLAST – Find papers about a protein or its homologs

 

Align XP_008806285.1 to PF04577 (DUF563)

XP_008806285.1 has 476 amino acids

Query:       DUF563  [M=209]
Accession:   PF04577.14
Description: Protein of unknown function (DUF563)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    6.6e-23   68.1   0.1    9.7e-23   67.5   0.1    1.2  1  XP_008806285.1  


Domain annotation for each sequence (and alignments):
>> XP_008806285.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   67.5   0.1   9.7e-23   9.7e-23       1     190 [.     181     389 ..     181     409 .. 0.74

  Alignments for each domain:
  == domain 1  score: 67.5 bits;  conditional E-value: 9.7e-23
          DUF563   1 nnygHwlvdvlprlllleqlvlddddrilvpalaspqpfqrell.kllgirpekrikveld.epvhve.klivpvppr......ssggfqgallp 86 
                     n++ H ++dv+ +l++ +  ++ +   +l+++   ++ +++ ++  + ++++ ++i +++d e+v++  ++i+  + +      s      +  p
  XP_008806285.1 181 NHF-HDFTDVFVPLFISSYQFHGEV-QFLISD--FRSWWVNKFIlIFRQLSNYEIINMDSDqESVRCFpRVIMGPSFHkvlgvdS------SRSP 265
                     678.889999777755554444444.477777..777777777734455599999999988666777755555555554443323......3333 PP

          DUF563  87 ......klrdrlrerlnlekr..............kkptrvlyisRlkagsRrilNeeevlkllpkrgfe..vvdpe.slsfeeqiklfssakvi 158
                            + +++r++++le+                + +r+l+isR  ++ R++ Ne  +++  ++ gf+  + +p+ s  + + ++l++sa+v+
  XP_008806285.1 266 agcsivDFKAAMRKAFGLERAtvtppedvewdmrrWR-PRLLIISR--KNTRKFMNERGMVDMATSLGFDvrIGQPDmSTEVSKFARLVNSADVM 357
                     445566***************9966666655555333.7*******..99***********99998887754677998999************** PP

          DUF563 159 vgphGsgltnliFmppgttvielvppnrldns 190
                      g+hG+gltn++F+p g++vi +vp ++ld+ 
  XP_008806285.1 358 LGVHGAGLTNMVFLPAGAVVIQVVPMGGLDWL 389
                     *************************9999876 PP



Or compare XP_008806285.1 to CDD or PaperBLAST