PaperBLAST – Find papers about a protein or its homologs

 

Align XP_012052709.1 to PF04577 (DUF563)

XP_012052709.1 has 561 amino acids

Query:       DUF563  [M=209]
Accession:   PF04577.14
Description: Protein of unknown function (DUF563)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.2e-24   72.9   0.0    2.4e-23   69.5   0.0    2.2  2  XP_012052709.1  


Domain annotation for each sequence (and alignments):
>> XP_012052709.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.8   0.0     0.026     0.026      37     112 ..     201     292 ..     178     314 .. 0.53
   2 !   69.5   0.0   2.4e-23   2.4e-23      88     205 ..     377     503 ..     364     507 .. 0.82

  Alignments for each domain:
  == domain 1  score: 0.8 bits;  conditional E-value: 0.026
          DUF563  37 qpfqrellkllgirpekrikveldepvhve.........klivpvpprssggfqgallpklrdrlrerlnlekr........kkp.....trvly 109
                     ++f++ell  lg+    r +  ld++v ++         + i+p+ + ++ +  + + + l+++++ ++  e +        +       +rv++
  XP_012052709.1 201 YHFAAELL--LGL---WRTYSSLDPTVSAQgvthlpspsRMIFPHVSAGKWNDYAKMNSYLSRAIFPSMSYEYQndfldrmdT-GrafllERVVF 289
                     36666666..666...4444555666666665555555555555555555555555555555555555555552222222211.02233345555 PP

          DUF563 110 isR 112
                      +R
  XP_012052709.1 290 ADR 292
                     555 PP

  == domain 2  score: 69.5 bits;  conditional E-value: 2.4e-23
          DUF563  88 lrdrlrerlnlekrkkptrvlyisRlkagsRrilNee..evl....kllpkrgfe..vvdpeslsfeeqiklfssakvivgphGsgltnliFm.. 172
                     lr+++++    e  +kp  ++y+sR++ g+R +  e    ++    +l +k+g+e  +v++++l+  eqi+l + + v++g+hG glt+l++m  
  XP_012052709.1 377 LREKIMKEKQAEA-SKP-VITYVSRQDWGRRMLKKEShdSLVkelhDLEEKYGWEvnIVSMDKLTRDEQIRLSARTTVMMGVHGNGLTHLLWMng 469
                     4455555555555.899.*******88888888887765444433255558888877************************************65 PP

          DUF563 173 .ppgttvielvppnrldnsfenlaallglkyayv 205
                      +p++tvie+++p+++   +e  +++lg+ky++v
  XP_012052709.1 470 qNPRATVIEFFFPGGFAEDYEFTSRALGIKYYGV 503
                     4458***************************987 PP



Or compare XP_012052709.1 to CDD or PaperBLAST