PaperBLAST – Find papers about a protein or its homologs

 

Align XP_751886.1 to PF04577 (DUF563)

XP_751886.1 has 488 amino acids

Query:       DUF563  [M=209]
Accession:   PF04577.14
Description: Protein of unknown function (DUF563)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.5e-54  171.4   0.2    2.1e-54  171.0   0.2    1.2  1  XP_751886.1  


Domain annotation for each sequence (and alignments):
>> XP_751886.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  171.0   0.2   2.1e-54   2.1e-54       1     207 [.     208     442 ..     208     444 .. 0.91

  Alignments for each domain:
  == domain 1  score: 171.0 bits;  conditional E-value: 2.1e-54
       DUF563   1 nnygHwlvdvlprlllleqlvlddd...............drilvpalaspq..........pfqrellkllgirpekrikveldepvhveklivpvp 73 
                  n++ H+l+++++++++++ l+++ +               +          q          p++ +l+k++++rp  ri  +l++++++e+livp +
  XP_751886.1 208 NVW-HSLMEIFSMTMTFDVLRMTAGpnphrplfsigdienT----------QvvildeieegPYF-DLWKIFAQRPLLRI-NDLHPTNEFENLIVPLA 292
                  689.*********************9998655555555442..........45555555566999.8*************.***************** PP

       DUF563  74 prssggfqgallp..........klrdrlrerlnlekr...kkp.trvlyisRlkagsRrilNeeevl....kllpkrgfevvdpeslsfeeqiklfs 153
                  + s++ +qg +++          ++++r+++++++e r   ++p + v++i+R  +gsR+++N+++++    k++p+++++++d++s++f+eq+++ +
  XP_751886.1 293 GGSNPLWQGDWEIhscedsalvrTFSRRILSHFHVEFRrprQGPqIVVTFIDR--TGSRKLINQKDYFntvkKQFPHITVQMIDFASIPFQEQLRIAQ 388
                  *************************************65553338********..************9999*************************** PP

       DUF563 154 sakvivgphGsgltnliFmppgttvielvppnrldnsfenlaallglkyayvlg 207
                   ++++vg+hG+glt+ iF+p+g++++e++pp+ +++ f+nla+llg+ y++ ++
  XP_751886.1 389 GSDILVGVHGAGLTHGIFLPSGSVMVEILPPGLNHKGFRNLASLLGHLYFSAHA 442
                  **************************************************9886 PP



Or compare XP_751886.1 to CDD or PaperBLAST