VIMSS102559 has 166 amino acids
Query: YezG-like [M=146] Accession: PF04634.16 Description: Immunity protein YezG-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-57 178.1 7.3 6.6e-57 177.9 7.3 1.0 1 VIMSS102559 Domain annotation for each sequence (and alignments): >> VIMSS102559 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 177.9 7.3 6.6e-57 6.6e-57 1 146 [] 7 152 .. 7 152 .. 0.99 Alignments for each domain: == domain 1 score: 177.9 bits; conditional E-value: 6.6e-57 YezG-like 1 lkelYeeiaekiidmiPeeWekvylyaevledsgevyFyylkkesekliysheipekynvseeeykkllkeLyelikelreefkkeeqeaWtnltlsl 98 +++lY+eia++i++miP+eWekvy++a++++++gev+F+y+k++s++l+y+++ip++yn+s +++++l+++Ly+l++elr+ fk+e+ e+Wt++++++ VIMSS102559 7 ISKLYNEIANEISSMIPVEWEKVYTMAYIDDGGGEVFFNYTKPGSDDLNYYTDIPKEYNISVQVFDDLWMDLYDLFEELRDLFKEEDLEPWTSCEFDF 104 689*********************************************************************************************** PP YezG-like 99 kksGklkiefnyddllnseldsserkiiwkykklgilpeeekekelle 146 +++Gklk++ +y d++n+e+d+ r+++++ykk+g++pe+e+e+e+++ VIMSS102559 105 TSEGKLKVSLDYIDWINTEFDQLGRENYYMYKKFGVIPEMEYEMEEIK 152 ********************************************9985 PP
Or compare VIMSS102559 to CDD or PaperBLAST