VIMSS1291810 has 128 amino acids
Query: YezG-like [M=146]
Accession: PF04634.16
Description: Immunity protein YezG-like
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-35 108.3 3.5 2.2e-35 108.1 3.5 1.1 1 VIMSS1291810
Domain annotation for each sequence (and alignments):
>> VIMSS1291810
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 108.1 3.5 2.2e-35 2.2e-35 44 145 .. 12 113 .. 2 114 .. 0.95
Alignments for each domain:
== domain 1 score: 108.1 bits; conditional E-value: 2.2e-35
YezG-like 44 esekliysheipekynvseeeykkllkeLyelikelreefkkeeqeaWtnltlslkksGklkiefnyddllnseldsserkiiwkykklgilpeeek 140
+s++l+y+++ip++yn+s +++++l+++Ly+l++elr+ fk+e e+Wt+++++++++Gklk++f+y d++nse+ + r++++ky+k+gilpe+e+
VIMSS1291810 12 NSDELNYYTDIPKEYNISVQVFDDLWMDLYDLFEELRNLFKEEGLEPWTSCEFDFTREGKLKVSFDYIDWINSEFGQVGRQNYYKYRKFGILPETEY 108
5679********************************************************************************************9 PP
YezG-like 141 ekell 145
e +++
VIMSS1291810 109 EINKV 113
98876 PP
Or compare VIMSS1291810 to CDD or PaperBLAST