WP_001008493.1 has 166 amino acids
Query: YezG-like [M=146] Accession: PF04634.16 Description: Immunity protein YezG-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-54 170.6 9.2 1.3e-54 170.4 9.2 1.0 1 WP_001008493.1 Domain annotation for each sequence (and alignments): >> WP_001008493.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 170.4 9.2 1.3e-54 1.3e-54 1 146 [] 7 152 .. 7 152 .. 0.99 Alignments for each domain: == domain 1 score: 170.4 bits; conditional E-value: 1.3e-54 YezG-like 1 lkelYeeiaekiidmiPeeWekvylyaevledsgevyFyylkkesekliysheipekynvseeeykkllkeLyelikelreefkkeeqeaWtnlt 95 l+++Y+eia++i+ miP+eWe+v+++a+v++++gev+F+y+k++s++l+y++ ip++ynvse+++ +l+++Ly+l+k+lr+ fk+e+ e+Wt+++ WP_001008493.1 7 LSQMYNEIANEISGMIPVEWEQVFTIAYVTDQAGEVIFNYTKPGSDELNYYTYIPREYNVSEKVFYDLWTDLYRLFKKLRNAFKEEDLEPWTSCE 101 689******************************************************************************************** PP YezG-like 96 lslkksGklkiefnyddllnseldsserkiiwkykklgilpeeekekelle 146 ++++++Gklk++f+y d++n+e+d+ r+++++ykk+g++pe+e+e+e+++ WP_001008493.1 102 FDFTSEGKLKVSFDYIDWINTEFDQLGRENYYMYKKFGVIPEMEYEMEEVK 152 ***********************************************9885 PP
Or compare WP_001008493.1 to CDD or PaperBLAST