SwissProt::Q9AQW1 has 767 amino acids
Query: DUF630 [M=59]
Accession: PF04783.16
Description: Protein of unknown function (DUF630)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-28 85.0 5.4 7.3e-28 82.9 5.4 2.3 1 SwissProt::Q9AQW1
Domain annotation for each sequence (and alignments):
>> SwissProt::Q9AQW1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 82.9 5.4 7.3e-28 7.3e-28 1 59 [] 1 59 [. 1 59 [. 0.99
Alignments for each domain:
== domain 1 score: 82.9 bits; conditional E-value: 7.3e-28
DUF630 1 MGcaaSklddeeavalCreRkrllkqaveaRyaLAaaHvaYlqSLrnvgaaLrrFaeee 59
MGc+aSk+++e++v++C+eR+r++k+av++R++LA+aH++Yl+SLr ++aaL+rFa+++
SwissProt::Q9AQW1 1 MGCTASKVEQEDTVRRCKERRRHMKEAVASRQQLASAHADYLRSLRLTAAALSRFAQGH 59
********************************************************986 PP
Or compare SwissProt::Q9AQW1 to CDD or PaperBLAST