VIMSS10089678 has 743 amino acids
Query: DUF630 [M=59]
Accession: PF04783.16
Description: Protein of unknown function (DUF630)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.1e-29 85.9 0.7 2.7e-28 84.3 0.7 2.0 1 VIMSS10089678
Domain annotation for each sequence (and alignments):
>> VIMSS10089678
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 84.3 0.7 2.7e-28 2.7e-28 1 59 [] 1 59 [. 1 59 [. 0.98
Alignments for each domain:
== domain 1 score: 84.3 bits; conditional E-value: 2.7e-28
DUF630 1 MGcaaSklddeeavalCreRkrllkqaveaRyaLAaaHvaYlqSLrnvgaaLrrFaeee 59
MG+++S++d+++a++lCreRk++++qa++ R+ LAaaHv+Y+qSL+++g+aLr+F e+e
VIMSS10089678 1 MGASTSRIDEDKALQLCRERKKFVQQALDGRCLLAAAHVSYVQSLKSTGTALRKFSETE 59
*******************************************************9986 PP
Or compare VIMSS10089678 to CDD or PaperBLAST