PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001078202.2 to PF04852 (DUF640)

NP_001078202.2 has 195 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      6e-70  219.5   0.0    8.9e-70  219.0   0.0    1.2  1  NP_001078202.2  


Domain annotation for each sequence (and alignments):
>> NP_001078202.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  219.0   0.0   8.9e-70   8.9e-70       9     126 .]      44     161 ..      33     161 .. 0.97

  Alignments for each domain:
  == domain 1  score: 219.0 bits;  conditional E-value: 8.9e-70
          DUF640   9 kklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraafeee 103
                     ++lsrye+qkrrdwntf +yl+++rPPl+l+rcsgahvleflryldqfGktkvh++ c+f+G+++++apc cPlrqawGsldaliGrlraafee+
  NP_001078202.2  44 NQLSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTHLCPFFGHPNPPAPCACPLRQAWGSLDALIGRLRAAFEEN 138
                     689******************************************************************************************** PP

          DUF640 104 ggkaeanPfaaravrlylrevrd 126
                     gg++e+nPf+aravrlylrevrd
  NP_001078202.2 139 GGSPETNPFGARAVRLYLREVRD 161
                     **********************8 PP



Or compare NP_001078202.2 to CDD or PaperBLAST