NP_001078202.2 has 195 amino acids
Query: DUF640 [M=126] Accession: PF04852.12 Description: Protein of unknown function (DUF640) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-70 219.5 0.0 8.9e-70 219.0 0.0 1.2 1 NP_001078202.2 Domain annotation for each sequence (and alignments): >> NP_001078202.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 219.0 0.0 8.9e-70 8.9e-70 9 126 .] 44 161 .. 33 161 .. 0.97 Alignments for each domain: == domain 1 score: 219.0 bits; conditional E-value: 8.9e-70 DUF640 9 kklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraafeee 103 ++lsrye+qkrrdwntf +yl+++rPPl+l+rcsgahvleflryldqfGktkvh++ c+f+G+++++apc cPlrqawGsldaliGrlraafee+ NP_001078202.2 44 NQLSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTHLCPFFGHPNPPAPCACPLRQAWGSLDALIGRLRAAFEEN 138 689******************************************************************************************** PP DUF640 104 ggkaeanPfaaravrlylrevrd 126 gg++e+nPf+aravrlylrevrd NP_001078202.2 139 GGSPETNPFGARAVRLYLREVRD 161 **********************8 PP
Or compare NP_001078202.2 to CDD or PaperBLAST