PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001142841.2 to PF04852 (DUF640)

NP_001142841.2 has 200 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.1e-70  221.0   0.0    3.4e-70  220.3   0.0    1.2  1  NP_001142841.2  


Domain annotation for each sequence (and alignments):
>> NP_001142841.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  220.3   0.0   3.4e-70   3.4e-70       6     126 .]      32     152 ..      28     152 .. 0.98

  Alignments for each domain:
  == domain 1  score: 220.3 bits;  conditional E-value: 3.4e-70
          DUF640   6 skPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraaf 100
                      +P++ srye+qkrrdwntf +yl+++rPPl+la+csgahvleflryldqfGktkvh +ac+f+G+++++apc cPlrqawGsldal+Grlraaf
  NP_001142841.2  32 MTPQSPSRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHGPACPFFGHPNPPAPCPCPLRQAWGSLDALVGRLRAAF 126
                     578899***************************************************************************************** PP

          DUF640 101 eeeggkaeanPfaaravrlylrevrd 126
                     ee+gg++e+nPfaaravrlylrevr+
  NP_001142841.2 127 EENGGRPESNPFAARAVRLYLREVRE 152
                     ************************97 PP



Or compare NP_001142841.2 to CDD or PaperBLAST